PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009798121.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 702aa    MW: 79171.3 Da    PI: 5.6186
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009798121.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS353.82.6e-1083246982374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL++cAea +s + +   ++L+++++++sp gdp+ Rla +f++AL+ar a+   + ++++++ ++s  + ++ l+a++++  ++P+ ++s++
  XP_009798121.1 324 TSLLTRCAEAAASYNSKTFVEVLSKIRQHSSPFGDPTARLAYCFANALEARFAG--GGGVDTITTPKKSILSAADFLKAYQVYITACPFKRMSNI 416
                     689**************************************************9..55556666666666789********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN+ I + ++++ +vHiiDf+i +G+QWp++++ ++ Rp+gpp+l+iTg++ p++g   +e++eetg+rL+++++++gvpfe+++ +ak+++d+
  XP_009798121.1 417 FANKSIAKLTSEAPKVHIIDFGILYGFQWPCIIHGISLRPGGPPKLKITGIDFPQPGfrPAERVEETGRRLENYCKRFGVPFEYKA-IAKKWDDI 510
                     ********************************************************9*****************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     +le+L+++++E+++Vn+ ++l++++de+v ++    +r++vL+l+k+++P+ +v+   +a +n++ F +rf eal ++s+ fd++ea++ re+e 
  XP_009798121.1 511 KLEHLNIEQDETVVVNCLYRLKNVPDETVLTNGnnnPRNAVLRLIKEINPHWFVHGIVNAMYNASFFTTRFREALFHFSSQFDMFEATMTREDEG 605
                     ***************************9977655669********************************************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r+  E+e++gr+i+nv+aceg+er+er e++++W+ r + aGF+++pl+++++k++k+ +r+++ + + v+e+s+++++gWk+r ++++S+W+
  XP_009798121.1 606 RMIFEQEVFGRDIMNVIACEGTERVERPESYKQWSVRNQIAGFRQLPLNQDIVKEVKAKVRMFYHRDFLVDEDSNWMLQGWKGRIMYALSVWQ 698
                     ****************************************************************999*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.464297678IPR005202Transcription factor GRAS
PfamPF035149.1E-106324698IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MNTNTYFPSV DHRSTDGLEC CHRFAMASTN LGNEFSSTDI HDVVFFSSSN GTSSNNDEVV  60
VEGGGGGGGC DQTVVESDYF DGVFKYIQQM LLEEEDDLES RPCMFQDCIA LQAAEKSFYD  120
ALTDNNNDDP TIVEHCSSTD FPVNHGFIST THCLQDDNFN HFLDQSDLIS DFDCSNTGIR  180
GNTPLNNNCQ VVAAANDDHR NIYYGVNSTN TNNQGGTSKS EGKKKHNRED CGESSNGPNS  240
KQFASNGAEE TEEKTHEEYY DKAVLCPDMN PAFYVEDSCD DGSRSSSENA AWDKQKSRHI  300
KQSKRGRPRG TKKGVKTNEV VDLTSLLTRC AEAAASYNSK TFVEVLSKIR QHSSPFGDPT  360
ARLAYCFANA LEARFAGGGG VDTITTPKKS ILSAADFLKA YQVYITACPF KRMSNIFANK  420
SIAKLTSEAP KVHIIDFGIL YGFQWPCIIH GISLRPGGPP KLKITGIDFP QPGFRPAERV  480
EETGRRLENY CKRFGVPFEY KAIAKKWDDI KLEHLNIEQD ETVVVNCLYR LKNVPDETVL  540
TNGNNNPRNA VLRLIKEINP HWFVHGIVNA MYNASFFTTR FREALFHFSS QFDMFEATMT  600
REDEGRMIFE QEVFGRDIMN VIACEGTERV ERPESYKQWS VRNQIAGFRQ LPLNQDIVKE  660
VKAKVRMFYH RDFLVDEDSN WMLQGWKGRI MYALSVWQPI HK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-483236985375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798121.10.0PREDICTED: scarecrow-like protein 30
TrEMBLM1CZT40.0M1CZT4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000782860.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-154GRAS family protein